PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C008423P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 314aa    MW: 36285.8 Da    PI: 9.5341
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C008423P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14e-182974147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G  +W++Ia++++ gR++k+c++rw++ 
   MELO3C008423P1 29 RGHWRPAEDEKLRQLVEQYGAQNWNSIAEKLQ-GRSGKSCRLRWFNQ 74
                     899*****************************.***********996 PP

2Myb_DNA-binding56.94.7e-1881124146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++++eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ 
   MELO3C008423P1  81 RKPFSEEEEERLLGAHRIHGNK-WSLIARLFP-GRTDNAVKNHWHV 124
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.3762475IPR017930Myb domain
SuperFamilySSF466897.65E-3027122IPR009057Homeodomain-like
SMARTSM007178.4E-152877IPR001005SANT/Myb domain
PfamPF002493.2E-172974IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-263082IPR009057Homeodomain-like
CDDcd001671.88E-133273No hitNo description
PROSITE profilePS5129425.59876130IPR017930Myb domain
SMARTSM007174.9E-1480128IPR001005SANT/Myb domain
PfamPF002494.4E-1581123IPR001005SANT/Myb domain
CDDcd001676.60E-1183123No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2083129IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MKDSSGDHNN YNNNLHVGYH DQYKASCPRG HWRPAEDEKL RQLVEQYGAQ NWNSIAEKLQ  60
GRSGKSCRLR WFNQLDPRII RKPFSEEEEE RLLGAHRIHG NKWSLIARLF PGRTDNAVKN  120
HWHVIMARKQ REQSKLCGNK RTYQQFSNLI LNNNNNQITT TQSSSSTTNH HHLHHHHHPQ  180
FTTTILVSDY NNNNNSNSKD GMVWNFRQGF KGYSDNNNIL YRSSSSHYNY NYYPNSSSSS  240
SSSARFCFPN SKIPFGVFEF GSSSTTTLMK FMANTDDRNN NHDQQPQVLQ QEESLKDKDN  300
IPFIDFLGVG ISS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30291297107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818150.0LN681815.1 Cucumis melo genomic scaffold, anchoredscaffold00008.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008441565.10.0PREDICTED: transcriptional activator Myb-like isoform X1
TrEMBLA0A0A0KGJ91e-180A0A0A0KGJ9_CUCSA; Uncharacterized protein
STRINGVIT_18s0001g15260.t014e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-65myb domain protein 52